General Information

  • ID:  hor006795
  • Uniprot ID:  A1BN61
  • Protein name:  Follicle-stimulating hormone beta subunit
  • Gene name:  FSHB
  • Organism:  Pongo pygmaeus
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
  • GO MF:  NA
  • GO BP:  GO:0016913 follicle-stimulating hormone activity
  • GO CC:  GO:0010469 regulation of signaling receptor activity; GO:0007186 G protein-coupled receptor signaling pathway; GO:0042699 follicle-stimulating hormone signaling pathway

Sequence Information

  • Sequence:  CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
  • Length:  109
  • Propeptide:  MKTVQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
  • Signal peptide:  MKTVQFFFLFCCWKAICCNS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  In females FSH is responsible for the proliferation and survival of follicular somatic cells, and the cyclic recruitment of ovarian follicles into development from early antral stage through maturation to ovulation.the ??-subunit dictates binding specific
  • Mechanism:  In females FSH is responsible for the proliferation and survival of follicular somatic cells, and the cyclic recruitment of ovarian follicles into development from early antral stage through maturation to ovulation.the ??-subunit dictates binding specificity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA